Basic Information
| ID | DRAMP02786 |
| Sequence | SLQPGAPNVNNKDQPWQVSPHISRDDSGNTRTNINVQRHGENNDFEAGWSKVVRGPNKAKPTWHIGGTHRW |
| Length | 71 |
| Name | Acaloleptin-A3 (chain of Acaloleptin A; Insects, animals) |
| Source | Acalolepta luxuriosa (Udo longhorn beetle) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Escherichia coli, Aeromonas hydrophila, Erwinia persicinus, Serratia marcescens, Aeromonas hydrophila. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot |
P81592, Q76K70 |
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10077828, 19527748 |
|---|