Basic Information
| ID | DRAMP02788 |
|---|
| Sequence | SDDEDEEEEEDQPWQLNPNIARGDDGNTRADVNIKRRGENHDFEAGWSKVVDGPDRAKPTWHVGGTFRW |
|---|
| Length | 69 |
|---|
| Name | Acaloleptin-A5 (chain of Acaloleptin A; Insects, animals) |
|---|
| Source | Acalolepta luxuriosa (Udo longhorn beetle) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli, Aeromonas hydrophila, Erwinia persicinus, Serratia marcescens, Aeromonas hydrophila. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P81592, Q76K70 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10077828, 19527748 |
|---|
