| ID | DRAMP02831 |
|---|---|
| Sequence | MLTDLECAINSLIDVYHKYSLKKGNYHAVYRDDLKQLLETECPKFMKKKDADTWFKELDINQDGGINFEEFLVLVIKVGLEAHEEIHKE |
| Length | 89 |
| Name | Protein S100-A8 (Calgranulin-A; MRP-8; mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P28782, Q2NKR8 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 1610833, 8505358 |
Physicochemical Properties
| Residues | 89 |
|---|---|
| Sequence | MLTDLECAINSLIDVYHKYSLKKGNYHAVYRDDLKQLLETECPKFMKKKDADTWFKELDINQDGGINFEEFLVLVIKVGLEAHEEIHKE |
| Molecular Weight | 10459.87 |
| Grand Average of Hydropathy | -0.452 |
| Isoelectric Point | 5.151 |
| Charge at pH 7.4 | -6.638 |
| Secondary Structure | Helix: 0.348, Turn: 0.124, Sheet: 0.303 |
| Instability Index | 28.531 |
| Aromaticity | 0.101 |