| ID | DRAMP02847 |
|---|---|
| Sequence | QAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPATR |
| Length | 77 |
| Name | Apolipoprotein A-II (Antimicrobial peptide BAMP-1; mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Escherichia coli and yeasts. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P81644, Q2NKV9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9538260 |
Physicochemical Properties
| Residues | 77 |
|---|---|
| Sequence | QAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPATR |
| Molecular Weight | 8722.644 |
| Grand Average of Hydropathy | -0.716 |
| Isoelectric Point | 5.341 |
| Charge at pH 7.4 | -1.463 |
| Secondary Structure | Helix: 0.273, Turn: 0.182, Sheet: 0.286 |
| Instability Index | 43.238 |
| Aromaticity | 0.117 |