| ID | DRAMP02848 |
|---|---|
| Sequence | QAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPAT |
| Length | 76 |
| Name | Apolipoprotein A-II(1-76)(mammals, animals) |
| Source | Bos taurus (Bovine) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | Escherichia coli and yeasts. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P81644, Q2NKV9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9538260 |
Physicochemical Properties
| Residues | 76 |
|---|---|
| Sequence | QAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPAT |
| Molecular Weight | 8566.458 |
| Grand Average of Hydropathy | -0.666 |
| Isoelectric Point | 4.993 |
| Charge at pH 7.4 | -2.463 |
| Secondary Structure | Helix: 0.276, Turn: 0.184, Sheet: 0.289 |
| Instability Index | 43.675 |
| Aromaticity | 0.118 |