Basic Information
| ID | DRAMP02871 |
|---|
| Sequence | RRHMLRCMGDLGICRPACRQSEEPYLYCRNYQPCCLPFYVRIDISGKEGKNDWSRENRWPKVS |
|---|
| Length | 63 |
|---|
| Name | Beta-defensin 119 (Defensin, beta 119; mammals, animals) |
|---|
| Source | Bos taurus (Bovine) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli, Salmonella typhimurium;##Gram-positive bacteria: Staphylococcus aureus and Listeria monocytogenes. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q32P86, A7LM95 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | PubMed ID is not available |
|---|
