Basic Information
| ID | DRAMP02980 |
|---|
| Sequence | GLICESCRKIIQKLEDMVGPQPNEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKDILTGKKPQAICVDIKICKE |
|---|
| Length | 78 |
|---|
| Name | Antimicrobial peptide NK-lysin (NKL; pigs, mammals, animals) |
|---|
| Source | Sus scrofa (Pig) |
|---|
| Activity | Antimicrobial, Antibacterial, Antifungal, Antitumor |
|---|
| Pathogen | [with medium E]: Escherichia coli D21 (MIC=0.5 µM), Escherichia coli Bd2221/75 (MIC=10 µM), Acinetobacter calcoaceticus Ac 11 (MIC=7 µM), Bacillus megaterium Bmll (MIC=1.6 µM);##[without medium E]: Escherichia coli D21 (MIC=8 µM), Escherichia coli Bd2221/75 (MIC=39 µM), Bacillus megaterium Bmll (MIC=0.8 µM), Streptococcus pyogenes w.t. (MIC=34 µM), Candida albicans w.t. (MIC=31 µM). |
|---|
| Hemolytic Activity | [Ref.7737114] It exhibits no hemolytic activity at 170 µM against sheep red blood cells. |
|---|
| Cytotoxicity | [Ref.7737114] NK-lysin at 50μg/ml was able to give 90% lysis of 5'Cr-labelled YAC-1 cells in a medium with 2% fetal calf serum(FCS) and 75% lysis in phosphate-buffered saline(PBS), 15% lysis suspended in medium E. |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
Q29075 |
|---|
| PDB |
1NKL |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 7737114, 9334742 |
|---|
