| ID | DRAMP03318 |
|---|---|
| Sequence | GAILCNLCKDTVKLVENLLTVDGAQAVRQYIDNLCGKASGFLGTLCEKILSFGVDELVKLIENHVDPVVVCEKIHAC |
| Length | 77 |
| Name | Pore-forming peptide ameobapore B (EH-APP; saposin-like protein) |
| Source | Entamoeba histolytica (protozoan parasite) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive bacterium: Micrococcus luteus. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q24824 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 7715451 |
Physicochemical Properties
| Residues | 77 |
|---|---|
| Sequence | GAILCNLCKDTVKLVENLLTVDGAQAVRQYIDNLCGKASGFLGTLCEKILSFGVDELVKLIENHVDPVVVCEKIHAC |
| Molecular Weight | 8301.678 |
| Grand Average of Hydropathy | 0.475 |
| Isoelectric Point | 5.137 |
| Charge at pH 7.4 | -3.526 |
| Secondary Structure | Helix: 0.377, Turn: 0.169, Sheet: 0.273 |
| Instability Index | 14.535 |
| Aromaticity | 0.039 |