Basic Information
| ID | DRAMP03320 |
|---|
| Sequence | GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC |
|---|
| Length | 77 |
|---|
| Name | Pore-forming peptide ameobapore A (EH-APP; saposin-like protein) |
|---|
| Source | Entamoeba histolytica (protozoan parasite) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
|---|
| Pathogen | Gram-positive bacteria: Micrococcus luteus (MIC=1.9 µM), Bacillus megaterium (MIC=13 µM), Bacillus subtilis (MIC=27 µM), Staphylococcus aureus (MIC>15 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization(Cys5 and Cys77). |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P34095, Q24839 |
|---|
| PDB |
1OF9 |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 7715451, 8146160, 14970207 |
|---|
