| ID | DRAMP03075 |
|---|---|
| Sequence | WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK |
| Length | 36 |
| Name | Cecropin-D |
| Source | Antheraea pernyi (Chinese oak silk moth) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-negative bacteria: Escherichia coli D21 (MIC=0.37 µM), E. coli D31 (MIC=0.21 µM), Serratia marsescens (MIC=6.1 µM), S. marsescens Strain 122 (MIC=75 µM), Pseudomonas aeruginosa OT97 (MIC>81 µM), Xenorhabdus nematophilus Xn21 (MIC=16 µM);##Gram-positive bacteria: Bacillus subtilis Bsll (MIC>81 µM), Bacillus megaterium Bmll (MIC=24 µM), Bacillus thuringiensis Btll (MIC>81 µM), Streptococcus fecalis Ds16 (MIC>81 µM), S. fecalis AD-4 (MIC>81 µM), Micrococcus luteus MI11 (MIC=4 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P01511 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 6754375 |
Physicochemical Properties
| Residues | 36 |
|---|---|
| Sequence | WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK |
| Molecular Weight | 3807.32 |
| Grand Average of Hydropathy | -0.033 |
| Isoelectric Point | 9.978 |
| Charge at pH 7.4 | 1.555 |
| Secondary Structure | Helix: 0.250, Turn: 0.167, Sheet: 0.361 |
| Instability Index | 18.875 |
| Aromaticity | 0.056 |