| ID | DRAMP03078 |
|---|---|
| Sequence | VFVALILAIAIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATAR |
| Length | 55 |
| Name | Cecropin-A2 (Insects, animals) |
| Source | Drosophila yakuba (Fruit fly) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O61281 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9553148 |
Physicochemical Properties
| Residues | 55 |
|---|---|
| Sequence | VFVALILAIAIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATAR |
| Molecular Weight | 5753.66 |
| Grand Average of Hydropathy | 0.293 |
| Isoelectric Point | 10.433 |
| Charge at pH 7.4 | 3.552 |
| Secondary Structure | Helix: 0.309, Turn: 0.145, Sheet: 0.309 |
| Instability Index | 30.156 |
| Aromaticity | 0.036 |
