Basic Information
| ID | DRAMP20934 |
|---|
| Sequence | MNFNKFFVLFALIMVAVVGQSEAGWLKKLGKKIERVGQHTRDATIQTIGVAQQAVNVAATLKG |
|---|
| Length | 63 |
|---|
| Name | Lucilin Peptide |
|---|
| Source | L. eximia maggots |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram-, Wound-healing |
|---|
| Pathogen | [Ref.29890152] Gram-negative bacteria: Escherichia coli DH10B (MIC=7.8 μg/ml; MBC=7.8 μg/ml), Escherichia coli ESBL (MIC=15.6 μg/ml; MBC=15.6 μg/ml), Enterobacter cloacae (MIC=125 μg/ml; MBC=125 μg/ml) |
|---|
| Hemolytic Activity | [Ref.29890152]Hemolysis 0% at 0.24 μg/ml, hemolysis 0% at 0.49 μg/ml, hemolysis 0% at 0.98 μg/ml, hemolysis 0% at 1.95 μg/ml, hemolysis 0% at 3.91 μg/ml, hemolysis 0% at 7.81 μg/ml, hemolysis 0% at 15.60 μg/ml, hemolysis 0% at 31.00 μg/ml, hemolysis 0% at 63.00 μg/ml, hemolysis 0% at 125.00 μg/ml, hemolysis 0% at 250.00 μg/ml against human red blood cell |
|---|
| Cytotoxicity | [Ref.29890152] The peptide did not show cytotoxic activities against Vero cells. ##The peptide showed a toxic concentration from 62.5 μg/ml with IC50 of 58.30 μg/ml against PBMCs |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Free |
|---|
| Linear/Cyclic/Branched | Linear |
|---|
| Uniprot |
D7RT24 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 29890152 |
|---|
