| ID | DRAMP03177 |
|---|---|
| Sequence | SWLSKTYKKLENSAKKRISEGIAIAIQGGPR |
| Length | 31 |
| Name | Cecropin-P2 (CP2; nematodes, animals) |
| Source | Ascaris suum (Pig roundworm) (Ascaris lumbricoides) |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q5H7N6 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 15850460 |
Physicochemical Properties
| Residues | 31 |
|---|---|
| Sequence | SWLSKTYKKLENSAKKRISEGIAIAIQGGPR |
| Molecular Weight | 3430.953 |
| Grand Average of Hydropathy | -0.658 |
| Isoelectric Point | 10.289 |
| Charge at pH 7.4 | 4.24 |
| Secondary Structure | Helix: 0.258, Turn: 0.290, Sheet: 0.226 |
| Instability Index | 26.458 |
| Aromaticity | 0.065 |