| ID | DRAMP03260 |
|---|---|
| Sequence | EKYCPTPRNTSCKKMNIRNNCCRDSDCTSNAFCCAEPCGNFCHKASDKPGGRRVDPNASCQTGYVYW |
| Length | 67 |
| Name | U14-lycotoxin-Ls1a (Toxin-like structure LSTX-N1; spiders, Arthropods, animals) |
| Source | Lycosa singoriensis (Wolf spider) (Aranea singoriensis) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B6DD34 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19875276 |
Physicochemical Properties
| Residues | 67 |
|---|---|
| Sequence | EKYCPTPRNTSCKKMNIRNNCCRDSDCTSNAFCCAEPCGNFCHKASDKPGGRRVDPNASCQTGYVYW |
| Molecular Weight | 7504.386 |
| Grand Average of Hydropathy | -0.937 |
| Isoelectric Point | 8.593 |
| Charge at pH 7.4 | 3.442 |
| Secondary Structure | Helix: 0.134, Turn: 0.313, Sheet: 0.104 |
| Instability Index | 48.543 |
| Aromaticity | 0.09 |