| ID | DRAMP03266 |
|---|---|
| Sequence | DQYCPKSSITACKKMNIRNDCCKDDDCTGGSWCCATPCGNFCKYPTDRPGGKRAAGGKSCKTGYVYY |
| Length | 67 |
| Name | U15-lycotoxin-Ls1f (Toxin-like structure LSTX-N7; spiders, Arthropods, animals) |
| Source | Lycosa singoriensis (Wolf spider) (Aranea singoriensis) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | B6DD40 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19875276 |
Physicochemical Properties
| Residues | 67 |
|---|---|
| Sequence | DQYCPKSSITACKKMNIRNDCCKDDDCTGGSWCCATPCGNFCKYPTDRPGGKRAAGGKSCKTGYVYY |
| Molecular Weight | 7293.245 |
| Grand Average of Hydropathy | -0.796 |
| Isoelectric Point | 8.715 |
| Charge at pH 7.4 | 4.282 |
| Secondary Structure | Helix: 0.149, Turn: 0.284, Sheet: 0.075 |
| Instability Index | 47.757 |
| Aromaticity | 0.104 |