| ID | DRAMP03382 |
|---|---|
| Sequence | APQMKTREVAERTHKCSLVRGTCKSECNSWEYKYNYCHTEPCCVVREYKRMEKLLSTPKYTT |
| Length | 62 |
| Name | Beta-defensin 18 (BD-18, mBD-18; Defensin, beta 18; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KP5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 62 |
|---|---|
| Sequence | APQMKTREVAERTHKCSLVRGTCKSECNSWEYKYNYCHTEPCCVVREYKRMEKLLSTPKYTT |
| Molecular Weight | 7396.472 |
| Grand Average of Hydropathy | -0.989 |
| Isoelectric Point | 8.99 |
| Charge at pH 7.4 | 4.512 |
| Secondary Structure | Helix: 0.210, Turn: 0.161, Sheet: 0.226 |
| Instability Index | 37.668 |
| Aromaticity | 0.097 |
