| ID | DRAMP02682 |
|---|---|
| Sequence | GLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI |
| Length | 79 |
| Name | Beta-defensin 116 (Defensin, beta 116; primates, mammals, animals) |
| Source | Pan troglodytes (Chimpanzee) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KL1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 79 |
|---|---|
| Sequence | GLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI |
| Molecular Weight | 9071.042 |
| Grand Average of Hydropathy | -0.873 |
| Isoelectric Point | 8.275 |
| Charge at pH 7.4 | 1.463 |
| Secondary Structure | Helix: 0.241, Turn: 0.329, Sheet: 0.165 |
| Instability Index | 46.558 |
| Aromaticity | 0.089 |