| ID | DRAMP03386 |
|---|---|
| Sequence | GLFGFRSSKRQEPWIACELYQGLCRNACQKYEIQYLSCPKTRKCCLKYPRKITSF |
| Length | 55 |
| Name | Beta-defensin 29 (BD-29, mBD-29; Defensin, beta 29; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8BGW9 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16141072 |
Physicochemical Properties
| Residues | 55 |
|---|---|
| Sequence | GLFGFRSSKRQEPWIACELYQGLCRNACQKYEIQYLSCPKTRKCCLKYPRKITSF |
| Molecular Weight | 6541.654 |
| Grand Average of Hydropathy | -0.565 |
| Isoelectric Point | 9.505 |
| Charge at pH 7.4 | 7.389 |
| Secondary Structure | Helix: 0.291, Turn: 0.200, Sheet: 0.182 |
| Instability Index | 65.545 |
| Aromaticity | 0.145 |