| ID | DRAMP03391 |
|---|---|
| Sequence | QKCWNLHGKCRHRCSRKESVYVYCTNGKMCCVKPKYQPKPKPWMF |
| Length | 45 |
| Name | Beta-defensin 36 (BD-36, mBD-36; Defensin, beta 36; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8K3U4, A3KGR4, Q3V491 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 16141072 |
Physicochemical Properties
| Residues | 45 |
|---|---|
| Sequence | QKCWNLHGKCRHRCSRKESVYVYCTNGKMCCVKPKYQPKPKPWMF |
| Molecular Weight | 5478.542 |
| Grand Average of Hydropathy | -1.018 |
| Isoelectric Point | 9.742 |
| Charge at pH 7.4 | 9.457 |
| Secondary Structure | Helix: 0.222, Turn: 0.222, Sheet: 0.089 |
| Instability Index | 30.562 |
| Aromaticity | 0.133 |