| ID | DRAMP03602 |
|---|---|
| Sequence | QLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC |
| Length | 44 |
| Name | Human beta-defensin 27 (hBD-27; hBD27; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli K12. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19373462 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | QLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC |
| Molecular Weight | 5173.011 |
| Grand Average of Hydropathy | -0.507 |
| Isoelectric Point | 8.248 |
| Charge at pH 7.4 | 1.413 |
| Secondary Structure | Helix: 0.273, Turn: 0.182, Sheet: 0.250 |
| Instability Index | 39.718 |
| Aromaticity | 0.068 |