| ID | DRAMP03500 |
|---|---|
| Sequence | GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH |
| Length | 41 |
| Name | Virescein (Insects, animals) |
| Source | Heliothis virescens (Tobacco budworm moth) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P83416 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 41 |
|---|---|
| Sequence | GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH |
| Molecular Weight | 4389.202 |
| Grand Average of Hydropathy | -0.273 |
| Isoelectric Point | 10.843 |
| Charge at pH 7.4 | 8.609 |
| Secondary Structure | Helix: 0.268, Turn: 0.220, Sheet: 0.171 |
| Instability Index | 14.146 |
| Aromaticity | 0.073 |
