| ID | DRAMP03560 |
|---|---|
| Sequence | TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Length | 69 |
| Name | CXC chemokine GRObeta [5-73] (Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial, Antiparasitic, Chemotactic |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P19875 |
| PDB | 1QNK |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12949249, 10600366 |
Physicochemical Properties
| Residues | 69 |
|---|---|
| Sequence | TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Molecular Weight | 7539.914 |
| Grand Average of Hydropathy | -0.377 |
| Isoelectric Point | 9.75 |
| Charge at pH 7.4 | 7.162 |
| Secondary Structure | Helix: 0.232, Turn: 0.246, Sheet: 0.232 |
| Instability Index | 62.857 |
| Aromaticity | 0 |