Basic Information
| ID | DRAMP03585 |
|---|
| Sequence | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDES |
|---|
| Length | 68 |
|---|
| Name | Human TC-1 (Chain of Platelet basic protein; Human, mammals, animals) |
|---|
| Source | Homo sapiens (Human) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | Gram-positive bacteria: Bacillus subtilis (MBC=0.4 µM), Staphylococcus aureus (MBC=6.8 µM);##Gram-negative bacterium: Escherichia coli (MBC=3.4 µM).##Fungi: Cryptococcus neoformans (MFC=1.9 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P02775, B2R5F3, Q6IBJ8 |
|---|
| PDB |
1TVX resolved by X-ray. |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 10877842, 8034022 |
|---|
