| ID | DRAMP03614 |
|---|---|
| Sequence | QTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI |
| Length | 61 |
| Name | Beta-defensin 115 (Beta-defensin 15, DEFB-15; Defensin, beta 115; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KQ5 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 11780052 |
Physicochemical Properties
| Residues | 61 |
|---|---|
| Sequence | QTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI |
| Molecular Weight | 7241.281 |
| Grand Average of Hydropathy | -1.248 |
| Isoelectric Point | 8.974 |
| Charge at pH 7.4 | 4.497 |
| Secondary Structure | Helix: 0.197, Turn: 0.148, Sheet: 0.164 |
| Instability Index | 54.211 |
| Aromaticity | 0.066 |
