| ID | DRAMP03627 |
|---|---|
| Sequence | GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS |
| Length | 73 |
| Name | Beta-defensin 132 (Defensin, beta 132; Beta-defensin 32, BD-32; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q7Z7B7, B2RP72, Q4QY40 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 12620395 |
Physicochemical Properties
| Residues | 73 |
|---|---|
| Sequence | GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS |
| Molecular Weight | 8311.446 |
| Grand Average of Hydropathy | -0.834 |
| Isoelectric Point | 9.617 |
| Charge at pH 7.4 | 8.441 |
| Secondary Structure | Helix: 0.192, Turn: 0.274, Sheet: 0.110 |
| Instability Index | 44.138 |
| Aromaticity | 0.082 |