| ID | DRAMP03630 |
|---|---|
| Sequence | GPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK |
| Length | 53 |
| Name | Beta-defensin 135 (Defensin, beta 135; Human, mammals, animals) |
| Source | Homo sapiens (Human) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KP9, Q4QY37 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 53 |
|---|---|
| Sequence | GPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK |
| Molecular Weight | 6141.308 |
| Grand Average of Hydropathy | -0.117 |
| Isoelectric Point | 9.244 |
| Charge at pH 7.4 | 5.429 |
| Secondary Structure | Helix: 0.340, Turn: 0.208, Sheet: 0.151 |
| Instability Index | 35.5 |
| Aromaticity | 0.094 |