| ID | DRAMP03387 |
|---|---|
| Sequence | GVNMYIKRIYDTCWKLKGICRNTCQKEEIYHIFCGIQSLCCLEKKEMPVLFVK |
| Length | 53 |
| Name | Beta-defensin 30 (BD-30, mBD-30; Defensin, beta 30; Rodents, mammals, animals) |
| Source | Mus musculus (Mouse) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q30KN4 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865, 15489334 |
Physicochemical Properties
| Residues | 53 |
|---|---|
| Sequence | GVNMYIKRIYDTCWKLKGICRNTCQKEEIYHIFCGIQSLCCLEKKEMPVLFVK |
| Molecular Weight | 6318.589 |
| Grand Average of Hydropathy | -0.03 |
| Isoelectric Point | 8.828 |
| Charge at pH 7.4 | 3.427 |
| Secondary Structure | Helix: 0.358, Turn: 0.132, Sheet: 0.189 |
| Instability Index | 59.932 |
| Aromaticity | 0.113 |