| ID | DRAMP03445 |
|---|---|
| Sequence | GVNMYIRQIYDTCWKLKGHCRNVCGKKEIFHIFCGTQFLCCIERKEMPVLFVK |
| Length | 53 |
| Name | Beta-defensin 30 (BD-30, RBD-30; Defensin, beta 30; Rodents, mammals, animals) |
| Source | Rattus norvegicus (Rat) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram- |
| Pathogen | Gram-negative bacterium: Escherichia coli. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q32ZG2 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 16033865 |
Physicochemical Properties
| Residues | 53 |
|---|---|
| Sequence | GVNMYIRQIYDTCWKLKGHCRNVCGKKEIFHIFCGTQFLCCIERKEMPVLFVK |
| Molecular Weight | 6328.592 |
| Grand Average of Hydropathy | 0.025 |
| Isoelectric Point | 9.059 |
| Charge at pH 7.4 | 4.467 |
| Secondary Structure | Helix: 0.358, Turn: 0.132, Sheet: 0.151 |
| Instability Index | 47.083 |
| Aromaticity | 0.132 |