| ID | DRAMP03697 |
|---|---|
| Sequence | ARDAYIANDRNCVYTCALNPYCDSECKKNGADSGYCQWFGRFGNACWCKNLPDKVPIRIPGECR |
| Length | 64 |
| Name | Neurotoxin MeuNaTx-2 (Arthropods, animals) |
| Source | Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P86403 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 64 |
|---|---|
| Sequence | ARDAYIANDRNCVYTCALNPYCDSECKKNGADSGYCQWFGRFGNACWCKNLPDKVPIRIPGECR |
| Molecular Weight | 7242.139 |
| Grand Average of Hydropathy | -0.608 |
| Isoelectric Point | 8.192 |
| Charge at pH 7.4 | 1.396 |
| Secondary Structure | Helix: 0.234, Turn: 0.266, Sheet: 0.156 |
| Instability Index | 34.072 |
| Aromaticity | 0.125 |