| ID | DRAMP01019 |
|---|---|
| Sequence | KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC |
| Length | 47 |
| Name | VrD2 (Vigna radiata defensin 2; plant defensin) |
| Source | Vigna radiata |
| Activity | Antimicrobial, Antibacterial, Antifungal |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | 2GL1 |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | PubMed ID is not available |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC |
| Molecular Weight | 5503.123 |
| Grand Average of Hydropathy | -1.174 |
| Isoelectric Point | 8.513 |
| Charge at pH 7.4 | 2.429 |
| Secondary Structure | Helix: 0.128, Turn: 0.213, Sheet: 0.106 |
| Instability Index | 39.464 |
| Aromaticity | 0.085 |