Basic Information
| ID | DRAMP00429 |
|---|
| Sequence | LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC |
|---|
| Length | 50 |
|---|
| Name | Aesculus hippocastanum antimicrobial protein 1 (Ah-AMP1; Cys-rich; Plant defensin) |
|---|
| Source | Aesculus hippocastanum (Horse chestnut) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
|---|
| Pathogen | Gram-positive bacterium: Bacillus subtilis (IC50=100 µg/mL).##Fungi: [MA: Botrytis cinerea (IC50=25 µg/mL), Cladosporium sphaerospermum (IC50=0.5 µg/mL), Fusarium culmorum (IC50=12 µg/mL), Leptosphaeria maculans (IC50=0.5 µg/mL), Penicillium digitatum (IC50=6 µg/mL), Trichoderma viride (IC50>100 µg/mL), Septoria tritiei (IC50=0.5 µg/mL), Verticilium albo-atrum (IC50=6 µg/mL). MA+: Botrytis cinerea (IC50>100 µg/mL), Cladosporium sphaerospermum (IC50=12 µg/mL), Fusarium culmorum (IC50>100 µg/mL), Leptosphaeria maculans (IC50=6 µg/mL), Penicillium digitatum (IC50=25 µg/mL), Trichoderma viride (IC50>100 µg/mL), Septoria tritiei (IC50=1.5 µg/mL), Verticilium albo-atrum (IC50>100 µg/mL)].##NOTE: MA+ = MA supplemented with 1 mM CaCl2 and 50 mM KCl. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
Q7M1F3 |
|---|
| PDB |
1BK8 |
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 7628617, 10591099, 10656585 |
|---|
