| ID | DRAMP00455 |
|---|---|
| Sequence | LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC |
| Length | 47 |
| Name | Defensin-like protein 2 (Fabatin-2; Plant defensin) |
| Source | Vicia faba (Broad bean) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacteria: Bacillus subtilis, Enterococcus hirae;##Gram-negative bacterium: Pseudomonas aeruginosa. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | P81457 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 9103978 |
Physicochemical Properties
| Residues | 47 |
|---|---|
| Sequence | LLGRCKVKSNRFNGPCLTDTHCSTVCRGEGYKGGDCHGLRRRCMCLC |
| Molecular Weight | 5206.096 |
| Grand Average of Hydropathy | -0.423 |
| Isoelectric Point | 9.12 |
| Charge at pH 7.4 | 5.427 |
| Secondary Structure | Helix: 0.191, Turn: 0.255, Sheet: 0.149 |
| Instability Index | 43.304 |
| Aromaticity | 0.043 |
