Basic Information
| ID | DRAMP00431 |
|---|
| Sequence | KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC |
|---|
| Length | 46 |
|---|
| Name | Defensin-like protein 2 (Cp-thionin II; Cp-thionin-2; Gamma-thionin II; Plant defensin) |
|---|
| Source | Vigna unguiculata (Cowpea) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-positive bacterium: Staphylococcus aureus ATTC 25923 (MIC=128 mg/ml);##Gram-negative bacteria: Escherichia coli ATTC 25922 (MIC=64 mg/ml), Pseudomonas syringae (MIC=42 mg/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization of a C-terminal Cys residue (forming a disulfide bond) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P84920 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 16824043 |
|---|
