ABPDB

Basic Information

ID	DRAMP00396
Sequence	NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC
Length	49
Name	Ct-AMP1 (CtAMP1, C. ternatea-antimicrobial peptide 1; Plant defensin)
Source	Clitoria ternatea
Activity	Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
Pathogen	Gram-positive bacterium: Bacillus subtilis (IC50=15 µg/mL).##Medium A: Botrytis cinerea (IC50=20 µg/ml), Cladosporium sphaerospermum (IC50=6 µg/ml), Fusarium culmorum (IC50=10 µg/ml), Leptosphaeria maculans (IC50=6 µg/ml), Penicillium digitatum (IC50=20 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=2 µg/ml), Verticilium albo-atrum (IC50=2 µg/ml). NOTE: Medium B = 1/2 strength potato dextrose broth.##Medium B: Botrytis cinerea (IC50>100 µg/ml), Cladosporium sphaerospermum (IC50=100 µg/ml), Fusarium culmorum (IC50=50 µg/ml), Leptosphaeria maculans (IC50=20 µg/ml), Penicillium digitatum (IC50=80 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=80 µg/ml), Verticilium albo-atrum (IC50>100 µg/ml).##NOTE: Medium B = Medium A supplemented with 1 mM CaCl2 and 50 mM KCI.
Hemolytic Activity	No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity	Not included yet
N-terminal Modification	Not included yet
C-terminal Modification	Not included yet
Linear/Cyclic/Branched	Not included yet
Uniprot
PDB
3D View
PDB Download	Download PDB Predicted by Alphafold2
PubMed ID	7628617

Residues	49
Sequence	NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC
Molecular Weight	5614.221
Grand Average of Hydropathy	-0.849
Isoelectric Point	8.21
Charge at pH 7.4	1.464
Secondary Structure	Helix: 0.163, Turn: 0.245, Sheet: 0.143
Instability Index	16.722
Aromaticity	0.122

Address: No.2699 Qianjin Street, Changchun City, China. Zip Code: 130012. 苏ICP备2021057230号-1.