Basic Information
| ID | DRAMP00749 |
| Sequence | ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC |
| Length | 50 |
| Name | Defensin-like protein 1 (Dm-AMP1; Plant defensin) |
| Source | Dahlia merckii (Bedding dahlia) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antifungal |
| Pathogen | Gram-positive bacterium: Bacillus subtilis (IC50=150 µg/mL).##Medium A: Botrytis cinerea (IC50=12 µg/ml), Cladosporium sphaerospermum (IC50=3 µg/ml), Fusarium culmorum (IC50=5 µg/ml), Leptosphaeria maculans (IC50=1.5 µg/ml), Penicillium digitatum (IC50=2 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=1 µg/ml), Verticilium albo-atrum (IC50=4 µg/ml). NOTE: Medium B = 1/2 strength potato dextrose broth.##Medium B: Botrytis cinerea (IC50>100 µg/ml), Cladosporium sphaerospermum (IC50=12 µg/ml), Fusarium culmorum (IC50=8 µg/ml), Leptosphaeria maculans (IC50=15 µg/ml), Penicillium digitatum (IC50=70 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=4 µg/ml), Verticilium albo-atrum (IC50>100 µg/ml).##NOTE: Medium B = Medium A supplemented with 1 mM CaCl2 and 50 mM KCI. |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot |
P0C8Y4 |
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 13129623, 7628617, 8663029, 17216480 |
|---|