Basic Information
| ID | DRAMP00397 |
|---|
| Sequence | KFCEKPSGTWSGVCGNSGACKDQCIRLEGAKHGSCNYKPPAHRCICYYEC |
|---|
| Length | 50 |
|---|
| Name | Defensin D1 (Ns-D1; Plant defensin) |
|---|
| Source | Nigella sativa (Black cumin) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | Fungi: Aspergillus niger (IC50=3.5 µg/ml), Bipolaris sorokiniana (IC50=3.0 µg/ml), Fusarium oxysporum (IC50=9.5 µg/ml), Fusarium graminearum (IC50=6.9 µg/ml), Fusarium culmorum (IC50=6.9 µg/ml) and Botrytis cinerea (IC50=27.4 µg/ml).##Gram-positive bacteria: Clavibacter michiganensis (1.4 cm) and Bacillus subtilis (1.3 cm);##Gram-negative bacteria: Pseudomonas syringae (0.9 cm), Erwinia carotovora (0.7 cm) and Escherichia coli (1.2 cm).##NOTE: Inhibition zone; Defensin concentration (11 µg in 50 μl). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | Not included yet |
|---|
| N-terminal Modification | Not included yet |
|---|
| C-terminal Modification | Not included yet |
|---|
| Linear/Cyclic/Branched | Not included yet |
|---|
| Uniprot |
P86972 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 21144761 |
|---|
