| ID | DRAMP03716 |
|---|---|
| Sequence | KSTVGQKLKKKLNQAVDKVKEVLNKSEYMCPVVSSFCKQHCARLGKSGQCDLLECICS |
| Length | 58 |
| Name | Potassium channel toxin Hge-beta-KTx (HgebetaKTx; Arthropods, animals) |
| Source | Hadrurus gertschi (Scorpion) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q0GY41 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 17506894, 18030427 |
Physicochemical Properties
| Residues | 58 |
|---|---|
| Sequence | KSTVGQKLKKKLNQAVDKVKEVLNKSEYMCPVVSSFCKQHCARLGKSGQCDLLECICS |
| Molecular Weight | 6432.584 |
| Grand Average of Hydropathy | -0.328 |
| Isoelectric Point | 9.174 |
| Charge at pH 7.4 | 5.424 |
| Secondary Structure | Helix: 0.259, Turn: 0.207, Sheet: 0.207 |
| Instability Index | 33.807 |
| Aromaticity | 0.034 |