| ID | DRAMP18186 |
|---|---|
| Sequence | AKKPFVQRVKNAASKAYNKLKGLAMQSQYGCPIISNMCEDHCRRKKMEGQCDLLDCVCS |
| Length | 59 |
| Name | Beta-KTx-like peptide LaIT2 |
| Source | Liocheles australasiae (Wood scorpion) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | C7G3K3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19966481 |
Physicochemical Properties
| Residues | 59 |
|---|---|
| Sequence | AKKPFVQRVKNAASKAYNKLKGLAMQSQYGCPIISNMCEDHCRRKKMEGQCDLLDCVCS |
| Molecular Weight | 6638.792 |
| Grand Average of Hydropathy | -0.522 |
| Isoelectric Point | 9.196 |
| Charge at pH 7.4 | 5.476 |
| Secondary Structure | Helix: 0.203, Turn: 0.203, Sheet: 0.237 |
| Instability Index | 40.214 |
| Aromaticity | 0.051 |