| ID | DRAMP18201 |
|---|---|
| Sequence | LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPP |
| Length | 55 |
| Name | WB Piscidin 6 (fish, animals) |
| Source | Morone chrysops |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic |
| Pathogen | Staphylococcus aureus ATCC 29213(MIC >31.59uM) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 27552222 |
Physicochemical Properties
| Residues | 55 |
|---|---|
| Sequence | LFGSVKAWFKGAKKGFQDYRYQKDMAKMNKRYGPNWQQRGGQEPPADAQANDQPP |
| Molecular Weight | 6332.024 |
| Grand Average of Hydropathy | -1.44 |
| Isoelectric Point | 9.821 |
| Charge at pH 7.4 | 4.535 |
| Secondary Structure | Helix: 0.182, Turn: 0.273, Sheet: 0.182 |
| Instability Index | 38.26 |
| Aromaticity | 0.145 |