| ID | DRAMP18200 |
|---|---|
| Sequence | FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP |
| Length | 55 |
| Name | SB Piscidin 6 (fish, animals) |
| Source | Morone saxatilis |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Antiparasitic |
| Pathogen | Staphylococcus aureus ATCC 29213(MIC >32.11uM) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 27552222 |
Physicochemical Properties
| Residues | 55 |
|---|---|
| Sequence | FFGRLKSMWRGARGGLKAYKYQKDMAKMNKRYGPNWQQGGGQEPPADAQANDQPP |
| Molecular Weight | 6228.972 |
| Grand Average of Hydropathy | -1.362 |
| Isoelectric Point | 10.088 |
| Charge at pH 7.4 | 5.537 |
| Secondary Structure | Helix: 0.164, Turn: 0.309, Sheet: 0.218 |
| Instability Index | 45.404 |
| Aromaticity | 0.127 |