| ID | DRAMP03111 |
|---|---|
| Sequence | QSDALFVDIIDNVENAIHKAAKTGIGMVKPIENIFIPNQQKKSTEASN |
| Length | 48 |
| Name | Andropin (Insects, animals) |
| Source | Drosophila orena (Fruit fly) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8WSV0 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11965438 |
Physicochemical Properties
| Residues | 48 |
|---|---|
| Sequence | QSDALFVDIIDNVENAIHKAAKTGIGMVKPIENIFIPNQQKKSTEASN |
| Molecular Weight | 5238.881 |
| Grand Average of Hydropathy | -0.315 |
| Isoelectric Point | 5.585 |
| Charge at pH 7.4 | -1.414 |
| Secondary Structure | Helix: 0.271, Turn: 0.250, Sheet: 0.208 |
| Instability Index | 41.773 |
| Aromaticity | 0.042 |