| ID | DRAMP03109 |
|---|---|
| Sequence | VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK |
| Length | 34 |
| Name | Andropin (Insects, animals) |
| Source | Drosophila sechellia (Fruit fly) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8WSV2, B4HZP0, P81687 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11965438, 9725836 |
Physicochemical Properties
| Residues | 34 |
|---|---|
| Sequence | VFIDILDKMENAIHKAAQAGIGLAKPIENMILPK |
| Molecular Weight | 3703.419 |
| Grand Average of Hydropathy | 0.321 |
| Isoelectric Point | 6.731 |
| Charge at pH 7.4 | -0.447 |
| Secondary Structure | Helix: 0.324, Turn: 0.176, Sheet: 0.353 |
| Instability Index | 52.594 |
| Aromaticity | 0.029 |