| ID | DRAMP03107 |
|---|---|
| Sequence | FINLLDKVEDALHTGAQAGFKLIRPVERGATPKKSEKPEK |
| Length | 40 |
| Name | Andropin (Insects, animals) |
| Source | Drosophila teissieri (Fruit fly) |
| Activity | Antimicrobial, Antibacterial |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | Q8WSV1 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11965438 |
Physicochemical Properties
| Residues | 40 |
|---|---|
| Sequence | FINLLDKVEDALHTGAQAGFKLIRPVERGATPKKSEKPEK |
| Molecular Weight | 4433.074 |
| Grand Average of Hydropathy | -0.66 |
| Isoelectric Point | 9.307 |
| Charge at pH 7.4 | 1.584 |
| Secondary Structure | Helix: 0.250, Turn: 0.200, Sheet: 0.300 |
| Instability Index | 10.97 |
| Aromaticity | 0.05 |