| ID | DRAMP02333 |
|---|---|
| Sequence | FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP |
| Length | 44 |
| Name | Piscidin-4 (Pis-4; fish, chordates, animals) |
| Source | Morone chrysops x Morone saxatilis (white bass x striped sea-bass) |
| Activity | Antimicrobial, Antibacterial, Antiviral |
| Pathogen | No MICs found in DRAMP database |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | E3UVF6 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 19266617 |
Physicochemical Properties
| Residues | 44 |
|---|---|
| Sequence | FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP |
| Molecular Weight | 5313.871 |
| Grand Average of Hydropathy | -1.227 |
| Isoelectric Point | 11.232 |
| Charge at pH 7.4 | 4.627 |
| Secondary Structure | Helix: 0.250, Turn: 0.205, Sheet: 0.182 |
| Instability Index | 39.539 |
| Aromaticity | 0.136 |