Basic Information
| ID | DRAMP01462 |
| Sequence | GLFTLIKGAVKMIGKTVAKEAGKTGLELMACKVTNQC |
| Length | 37 |
| Name | Esculentin-2S (Frogs, amphibians, animals) |
| Source | Odorrana schmackeri (piebald odorous frog) |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
| Pathogen | Gram-positive bacterium: Staphylococcus aureus FDA 209P (MIC=2.6 µM);##Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=1.1 µM). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | No cytotoxicity information found |
| N-terminal Modification | Free |
| C-terminal Modification | Cyclization (Cys31 and Cys37) |
| Linear/Cyclic/Branched | Cyclic |
| Uniprot |
|
| PDB |
|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 16427248 |
|---|