Basic Information
| ID | DRAMP01476 |
|---|
| Sequence | GIFSLIKGAAQLIGKTVAKEAGKTGLELMACKVTKQC |
|---|
| Length | 37 |
|---|
| Name | Esculentin-2HSa (Frogs, amphibians, animals) |
|---|
| Source | Odorrana hosii (Hose's rock frog) (Rana hosii) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-positive bacterium: Staphylococcus aureus ATCC 25923 (MIC=32 µM);##Gram-negative bacterium: Escherichia coli ATCC 25726 (MIC=16 µM). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization (Cys31 and Cys37) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
P0C8T9 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 18621071 |
|---|
