Basic Information
| ID | DRAMP01519 |
|---|
| Sequence | GVFSFLKTGAKLLGSTLLKMAGKAGAEHLACKATNQC |
|---|
| Length | 37 |
|---|
| Name | Esculentin-2PRa (Frogs, amphibians, animals) |
|---|
| Source | Rana pretiosa (North American oregon spotted frog) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal |
|---|
| Pathogen | Gram-negative bacterium: Escherichia coli;##Gram-positive bacterium: Staphylococcus aureus.##Yeast: Candida albicans. |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization (Cys31 and Cys37) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
|
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 21295070 |
|---|
