Basic Information
| ID | DRAMP01454 |
|---|
| Sequence | GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC |
|---|
| Length | 37 |
|---|
| Name | Esculentin-2JDa (Frogs, amphibians, animals) |
|---|
| Source | Odorrana jingdongensis (Jingdong frog) (Rana jingdongensis) |
|---|
| Activity | Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram- |
|---|
| Pathogen | Gram-negative bacteria: Escherichia coli (ATCC 25922) (MIC=34 µg/ml), Extended-spectrum ß-lactamases E. coli (ESBL) (MIC=34 µg/ml);##Gram-positive bacteria: Staphylococcus aureus (ATCC 25923) (MIC=8 µg/ml), Methicillin-resistant S. aureus (MRSA) (MIC=8 µg/ml). |
|---|
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
|---|
| Cytotoxicity | No cytotoxicity information found |
|---|
| N-terminal Modification | Free |
|---|
| C-terminal Modification | Cyclization (Cys31 and Cys37) |
|---|
| Linear/Cyclic/Branched | Cyclic |
|---|
| Uniprot |
B3A0M8 |
|---|
| PDB |
|
|---|
| 3D View | |
|---|
| PDB Download | Download PDB Predicted by Alphafold2 |
|---|
| PubMed ID | 22917879 |
|---|
