| ID | DRAMP03110 |
|---|---|
| Sequence | VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK |
| Length | 34 |
| Name | Andropin (Insects, animals) |
| Source | Drosophila mauritiana (Fruit fly) |
| Activity | Antimicrobial, Antibacterial, Antiprotozoal |
| Pathogen | Leishmania panamensis (EC50=23.45 µg/ml). |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | O16825, Q8WSV3 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 11965438 |
Physicochemical Properties
| Residues | 34 |
|---|---|
| Sequence | VFIDILDKMENAIHKAAQAGIGIAKPIEKMILPK |
| Molecular Weight | 3717.488 |
| Grand Average of Hydropathy | 0.329 |
| Isoelectric Point | 8.36 |
| Charge at pH 7.4 | 0.55 |
| Secondary Structure | Helix: 0.324, Turn: 0.147, Sheet: 0.324 |
| Instability Index | 59.685 |
| Aromaticity | 0.029 |