| ID | DRAMP18252 |
|---|---|
| Sequence | GDVMPESTPICAGFATLMSSIGLVKTIKGKC |
| Length | 31 |
| Name | Carnolysin A2(Bacteriocin) |
| Source | Carnobacterium maltaromaticum C2 |
| Activity | Antimicrobial, Antibacterial, Anti-Gram+ |
| Pathogen | Gram-positive(broad) |
| Hemolytic Activity | No hemolysis information or data found in the reference(s) presented in this entry |
| Cytotoxicity | Not included yet |
| N-terminal Modification | Not included yet |
| C-terminal Modification | Not included yet |
| Linear/Cyclic/Branched | Not included yet |
| Uniprot | W0FGJ7 |
| PDB | |
| 3D View | |
| PDB Download | Download PDB Predicted by Alphafold2 |
| PubMed ID | 24412962 |
Physicochemical Properties
| Residues | 31 |
|---|---|
| Sequence | GDVMPESTPICAGFATLMSSIGLVKTIKGKC |
| Molecular Weight | 3155.77 |
| Grand Average of Hydropathy | 0.539 |
| Isoelectric Point | 8.033 |
| Charge at pH 7.4 | 0.502 |
| Secondary Structure | Helix: 0.258, Turn: 0.290, Sheet: 0.226 |
| Instability Index | 46.913 |
| Aromaticity | 0.032 |